PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678423143
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 405aa    MW: 42470.2 Da    PI: 8.3713
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678423143genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702208.81.4e-641903474154
     DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelets 103
                 +a+CqdCGnqakkdC h+RCRtCCksrg+dC+thvkstWvpaa+rrerq ++ +++s++ +++ +          s++++++s+t++s+++++++++ts
  678423143 190 AAATCQDCGNQAKKDCPHRRCRTCCKSRGYDCTTHVKSTWVPAARRRERQLMAGSSQSTSGSKKPKLVGGGGG-GASQTTTTASHTSTSNTTPPRSFDTS 288
                5689*********************************************988888776666655333333322.35778888889999999999999998 PP

     DUF702 104 s........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                s        lP +v+++avf+cvrv+++ddge+e+aYq+ v+igGhvfkG+LydqGle+
  678423143 289 SshqdkeaaLPGQVRAPAVFKCVRVTALDDGEDEYAYQALVKIGGHVFKGFLYDQGLES 347
                889999999***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.9E-60192346IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.4E-26193235IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.6E-29298345IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MARFISCHKI DDAFYVANLF SRVVVRLHVV ATSRRLASSD SGAFADWVAS SSSSASASVS  60
TGDLSLGFNA TVTAGMWSSS AAPRHVNYGL SPEFFFVAPA EAASASAATL SFDPNAIGVG  120
VIPLLTAAPC PTTEEALNTN SSNPRGRNFL WHQQQQGQGH SSGYLKKPTN LEPSNLLQTN  180
CSPGIGCSSA AATCQDCGNQ AKKDCPHRRC RTCCKSRGYD CTTHVKSTWV PAARRRERQL  240
MAGSSQSTSG SKKPKLVGGG GGGASQTTTT ASHTSTSNTT PPRSFDTSSS HQDKEAALPG  300
QVRAPAVFKC VRVTALDDGE DEYAYQALVK IGGHVFKGFL YDQGLESRLP NISELYLGGG  360
ESRNNPTPSS APPPPQNPPV LDPSDMYAAP GACLLGGSSF SNPIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012835509.11e-115PREDICTED: uncharacterized protein LOC105956208
SwissprotQ94CK98e-77LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A022R8A61e-123A0A022R8A6_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000244381e-97(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76552331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.44e-71Lateral root primordium (LRP) protein-related